RAPGEF4,cAMP-GEFII
  • RAPGEF4,cAMP-GEFII

Anti-RAPGEF4 Antibody 100ul

Ref: AN-HPA028968-100ul
Anti-RAPGEF4

Información del producto

Polyclonal Antibody against Human RAPGEF4, Gene description: Rap guanine nucleotide exchange factor (GEF) 4, Alternative Gene Names: cAMP-GEFII, CGEF2, Validated applications: ICC, IHC, WB, Uniprot ID: Q8WZA2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RAPGEF4
Gene Description Rap guanine nucleotide exchange factor (GEF) 4
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence VIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGNRASNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVFMPNTQLC
Immunogen VIYGKGVVCTLHEGDDFGKLALVNDAPRAASIVLREDNCHFLRVDKEDFNRILRDVEANTVRLKEHDQDVLVLEKVPAGNRASNQGNSQPQQKYTVMSGTPEKILEHFLETIRLEATLNEATDSVLNDFIMMHCVFMPNTQLC
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names cAMP-GEFII, CGEF2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WZA2
HTS Code 3002150000
Gene ID 11069
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RAPGEF4 Antibody 100ul

Anti-RAPGEF4 Antibody 100ul