TAF4B,TAF2C2
  • TAF4B,TAF2C2

Anti-TAF4B Antibody 25ul

Ref: AN-HPA028937-25ul
Anti-TAF4B

Información del producto

Polyclonal Antibody against Human TAF4B, Gene description: TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa, Alternative Gene Names: TAF2C2, TAFII105, Validated applications: ICC, IHC, Uniprot ID: Q92750, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TAF4B
Gene Description TAF4b RNA polymerase II, TATA box binding protein (TBP)-associated factor, 105kDa
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDMVIATCTTTVTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAATGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVT
Immunogen PHLVPFLKKSVVALRQLLPNSQSFIQQCVQQTSSDMVIATCTTTVTTSPVVTTTVSSSQSEKSIIVSGATAPRTVSVQTLNPLAGPVGAKAGVVTLHSVGPTAATGGTTAGTGLLQTSKPLVTSVANTVTTVSLQPEKPVVSGTAVT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names TAF2C2, TAFII105
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92750
HTS Code 3002150000
Gene ID 6875
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TAF4B Antibody 25ul

Anti-TAF4B Antibody 25ul