TEAD3,ETFR-1,TEAD5
  • TEAD3,ETFR-1,TEAD5

Anti-TEAD3 Antibody 25ul

Ref: AN-HPA028906-25ul
Anti-TEAD3

Información del producto

Polyclonal Antibody against Human TEAD3, Gene description: TEA domain family member 3, Alternative Gene Names: ETFR-1, TEAD5, TEF-5, Validated applications: IHC, Uniprot ID: Q99594, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TEAD3
Gene Description TEA domain family member 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence QDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEK
Immunogen QDIKPFAQPAYPIQPPLPPTLSSYEPLAPLPSAAASVPVWQDRTIASSRLRLLEYSAFMEVQRDPDTYSKHLFVHIGQTNPAFSDPPLEAVDVRQIYDKFPEK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ETFR-1, TEAD5, TEF-5
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99594
HTS Code 3002150000
Gene ID 7005
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TEAD3 Antibody 25ul

Anti-TEAD3 Antibody 25ul