PLPP3,LPP3,PAP-2b
  • PLPP3,LPP3,PAP-2b

Anti-PLPP3 Antibody 100ul

Ref: AN-HPA028892-100ul
Anti-PLPP3

Información del producto

Polyclonal Antibody against Human PLPP3, Gene description: phospholipid phosphatase 3, Alternative Gene Names: LPP3, PAP-2b, PPAP2B, Validated applications: IHC, Uniprot ID: O14495, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name PLPP3
Gene Description phospholipid phosphatase 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence IAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSF
Immunogen IAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names LPP3, PAP-2b, PPAP2B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O14495
HTS Code 3002150000
Gene ID 8613
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PLPP3 Antibody 100ul

Anti-PLPP3 Antibody 100ul