SBDS,CGI-97
  • SBDS,CGI-97

Anti-SBDS Antibody 100ul

Ref: AN-HPA028891-100ul
Anti-SBDS

Información del producto

Polyclonal Antibody against Human SBDS, Gene description: Shwachman-Bodian-Diamond syndrome, Alternative Gene Names: CGI-97, FLJ10917, SDS, SWDS, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y3A5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SBDS
Gene Description Shwachman-Bodian-Diamond syndrome
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence PTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVK
Immunogen PTNQIRLTNVAVVRMKRAGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNVSKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCVNPETKRPYTVILIERAMKDIHYSVK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-97, FLJ10917, SDS, SWDS
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y3A5
HTS Code 3002150000
Gene ID 51119
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SBDS Antibody 100ul

Anti-SBDS Antibody 100ul