DAB2,DOC-2
  • DAB2,DOC-2

Anti-DAB2 Antibody 100ul

Ref: AN-HPA028888-100ul
Anti-DAB2

Información del producto

Polyclonal Antibody against Human DAB2, Gene description: Dab, mitogen-responsive phosphoprotein, homolog 2 (Drosophila), Alternative Gene Names: DOC-2, Validated applications: ICC, IHC, Uniprot ID: P98082, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DAB2
Gene Description Dab, mitogen-responsive phosphoprotein, homolog 2 (Drosophila)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence NAFSANLNFFPTPNPDPFRDDPFTQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQISNRTGKQEAQAGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNP
Immunogen NAFSANLNFFPTPNPDPFRDDPFTQPDQSTPSSFDSLKSPDQKKENSSSSSTPLSNGPLNGDVDYFGQQFDQISNRTGKQEAQAGPWPFSSSQTQPAVRTQNGVSEREQNGFSVKSSPNP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DOC-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P98082
HTS Code 3002150000
Gene ID 1601
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DAB2 Antibody 100ul

Anti-DAB2 Antibody 100ul