BAP1,hucep-6
  • BAP1,hucep-6

Anti-BAP1 Antibody 25ul

Ref: AN-HPA028815-25ul
Anti-BAP1

Información del producto

Polyclonal Antibody against Human BAP1, Gene description: BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase), Alternative Gene Names: hucep-6, KIAA0272, UCHL2, Validated applications: ICC, Uniprot ID: Q92560, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name BAP1
Gene Description BRCA1 associated protein-1 (ubiquitin carboxy-terminal hydrolase)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence EKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKP
Immunogen EKYSPKELLALLKCVEAEIANYEACLKEEVEKRKKFKIDDQRRTHNYDEFICTFISMLAQEGMLANLVEQNISVRRRQGVSIGRLHKQRKP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names hucep-6, KIAA0272, UCHL2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92560
HTS Code 3002150000
Gene ID 8314
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BAP1 Antibody 25ul

Anti-BAP1 Antibody 25ul