JAM2,C21orf43,CD322
  • JAM2,C21orf43,CD322

Anti-JAM2 Antibody 100ul

Ref: AN-HPA028789-100ul
Anti-JAM2

Información del producto

Polyclonal Antibody against Human JAM2, Gene description: junctional adhesion molecule 2, Alternative Gene Names: C21orf43, CD322, JAM-B, JAMB, VE-JAM, Validated applications: ICC, Uniprot ID: P57087, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name JAM2
Gene Description junctional adhesion molecule 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence GVCYAQRKGYFSKETSFQKSNSSSKATTMS
Immunogen GVCYAQRKGYFSKETSFQKSNSSSKATTMS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C21orf43, CD322, JAM-B, JAMB, VE-JAM
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P57087
HTS Code 3002150000
Gene ID 58494
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-JAM2 Antibody 100ul

Anti-JAM2 Antibody 100ul