HSPH1,HSP105A
  • HSPH1,HSP105A

Anti-HSPH1 Antibody 25ul

Ref: AN-HPA028675-25ul
Anti-HSPH1

Información del producto

Polyclonal Antibody against Human HSPH1, Gene description: heat shock 105kDa/110kDa protein 1, Alternative Gene Names: HSP105A, HSP105B, KIAA0201, NY-CO-25, Validated applications: ICC, IHC, WB, Uniprot ID: Q92598, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name HSPH1
Gene Description heat shock 105kDa/110kDa protein 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence TQPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLG
Immunogen TQPQVQTDAQQTSQSPPSPELTSEENKIPDADKANEKKVDQPPEAKKPKIKVVNVELPIEANLVWQLG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HSP105A, HSP105B, KIAA0201, NY-CO-25
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q92598
HTS Code 3002150000
Gene ID 10808
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HSPH1 Antibody 25ul

Anti-HSPH1 Antibody 25ul