ZMAT3,FLJ12296
  • ZMAT3,FLJ12296

Anti-ZMAT3 Antibody 100ul

Ref: AN-HPA028671-100ul
Anti-ZMAT3

Información del producto

Polyclonal Antibody against Human ZMAT3, Gene description: zinc finger, matrin-type 3, Alternative Gene Names: FLJ12296, MGC10613, PAG608, WIG-1, WIG1, Validated applications: ICC, Uniprot ID: Q9HA38, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZMAT3
Gene Description zinc finger, matrin-type 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MILLQHAVLPPPKQPSPSPPMSVATRSTGTLQLPPQKPFGQEASLPLAGEEELSKGGEQDCALEELCKP
Immunogen MILLQHAVLPPPKQPSPSPPMSVATRSTGTLQLPPQKPFGQEASLPLAGEEELSKGGEQDCALEELCKP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ12296, MGC10613, PAG608, WIG-1, WIG1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9HA38
HTS Code 3002150000
Gene ID 64393
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZMAT3 Antibody 100ul

Anti-ZMAT3 Antibody 100ul