PIP4K2C,FLJ22055
  • PIP4K2C,FLJ22055

Anti-PIP4K2C Antibody 25ul

Ref: AN-HPA028658-25ul
Anti-PIP4K2C

Información del producto

Polyclonal Antibody against Human PIP4K2C, Gene description: phosphatidylinositol-5-phosphate 4-kinase, type II, gamma, Alternative Gene Names: FLJ22055, PIP5K2C, Validated applications: IHC, Uniprot ID: Q8TBX8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PIP4K2C
Gene Description phosphatidylinositol-5-phosphate 4-kinase, type II, gamma
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLI
Immunogen LEKLKRDVEFLVQLKIMDYSLLLGIHDIIRGSEPEEEAPVREDESEVDGDCSLTGPPALVGSYGTSPEGIGGYIHSHRPLGPGEFESFIDVYAIRSAEGAPQKEVYFMGLI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ22055, PIP5K2C
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TBX8
HTS Code 3002150000
Gene ID 79837
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PIP4K2C Antibody 25ul

Anti-PIP4K2C Antibody 25ul