KDF1,C1orf172
  • KDF1,C1orf172

Anti-KDF1 Antibody 100ul

Ref: AN-HPA028639-100ul
Anti-KDF1

Información del producto

Polyclonal Antibody against Human KDF1, Gene description: keratinocyte differentiation factor 1, Alternative Gene Names: C1orf172, FLJ34633, RP11-344H11.3, Validated applications: IHC, WB, Uniprot ID: Q8NAX2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name KDF1
Gene Description keratinocyte differentiation factor 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence LDEQDAEGRLVRGIIRISTRKSRARPQTSEGRSTRAAAPTAAAPDSGHETMVGSGLSQDELTVQISQETTADAIARKLRPYGA
Immunogen LDEQDAEGRLVRGIIRISTRKSRARPQTSEGRSTRAAAPTAAAPDSGHETMVGSGLSQDELTVQISQETTADAIARKLRPYGA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf172, FLJ34633, RP11-344H11.3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8NAX2
HTS Code 3002150000
Gene ID 126695
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-KDF1 Antibody 100ul

Anti-KDF1 Antibody 100ul