GCH1,DYT14,DYT5
  • GCH1,DYT14,DYT5

Anti-GCH1 Antibody 100ul

Ref: AN-HPA028612-100ul
Anti-GCH1

Información del producto

Polyclonal Antibody against Human GCH1, Gene description: GTP cyclohydrolase 1, Alternative Gene Names: DYT14, DYT5, DYT5a, GCH, GTPCH1, Validated applications: ICC, IHC, Uniprot ID: P30793, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name GCH1
Gene Description GTP cyclohydrolase 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence ELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQE
Immunogen ELNLPNLAAAYSSILSSLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDAIFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DYT14, DYT5, DYT5a, GCH, GTPCH1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P30793
HTS Code 3002150000
Gene ID 2643
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GCH1 Antibody 100ul

Anti-GCH1 Antibody 100ul