RBM34,KIAA0117
  • RBM34,KIAA0117

Anti-RBM34 Antibody 100ul

Ref: AN-HPA028606-100ul
Anti-RBM34

Información del producto

Polyclonal Antibody against Human RBM34, Gene description: RNA binding motif protein 34, Alternative Gene Names: KIAA0117, Validated applications: ICC, IHC, WB, Uniprot ID: P42696, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RBM34
Gene Description RNA binding motif protein 34
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence GQVASSLFRGEHHSRGGTGRLASLFSSLEPQIQPVYVPVPKQTIKKTKRNEEEESTSQIERPLSQEPAKKVKAKKKHTNA
Immunogen GQVASSLFRGEHHSRGGTGRLASLFSSLEPQIQPVYVPVPKQTIKKTKRNEEEESTSQIERPLSQEPAKKVKAKKKHTNA
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names KIAA0117
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P42696
HTS Code 3002150000
Gene ID 23029
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RBM34 Antibody 100ul

Anti-RBM34 Antibody 100ul