SPAG17,CT143
  • SPAG17,CT143

Anti-SPAG17 Antibody 25ul

Ref: AN-HPA028597-25ul
Anti-SPAG17

Información del producto

Polyclonal Antibody against Human SPAG17, Gene description: sperm associated antigen 17, Alternative Gene Names: CT143, FLJ34497, PF6, RP4-776P7.2, Validated applications: IHC, Uniprot ID: Q6Q759, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name SPAG17
Gene Description sperm associated antigen 17
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence SVPLILHCMLEQVVATEEDLVPPSLREPSPRADGLDHRIAAHIVSLLPSLCLSEREKKNLHDIFLSEEENESKAV
Immunogen SVPLILHCMLEQVVATEEDLVPPSLREPSPRADGLDHRIAAHIVSLLPSLCLSEREKKNLHDIFLSEEENESKAV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CT143, FLJ34497, PF6, RP4-776P7.2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6Q759
HTS Code 3002150000
Gene ID 200162
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SPAG17 Antibody 25ul

Anti-SPAG17 Antibody 25ul