HENMT1,C1orf59
  • HENMT1,C1orf59

Anti-HENMT1 Antibody 100ul

Ref: AN-HPA028497-100ul
Anti-HENMT1

Información del producto

Polyclonal Antibody against Human HENMT1, Gene description: HEN1 methyltransferase homolog 1 (Arabidopsis), Alternative Gene Names: C1orf59, FLJ30525, HEN1, Validated applications: ICC, WB, Uniprot ID: Q5T8I9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name HENMT1
Gene Description HEN1 methyltransferase homolog 1 (Arabidopsis)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, WB
Sequence FNPLFPSVTLRDSDHKFEWTRMEFQTWALYVANRYDYSVEFTGVGEPPAGAENVGYCTQIGIFRKNGGKATESCLS
Immunogen FNPLFPSVTLRDSDHKFEWTRMEFQTWALYVANRYDYSVEFTGVGEPPAGAENVGYCTQIGIFRKNGGKATESCLS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C1orf59, FLJ30525, HEN1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T8I9
HTS Code 3002150000
Gene ID 113802
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-HENMT1 Antibody 100ul

Anti-HENMT1 Antibody 100ul