PRUNE1,DRES-17
  • PRUNE1,DRES-17

Anti-PRUNE1 Antibody 25ul

Ref: AN-HPA028411-25ul
Anti-PRUNE1

Información del producto

Polyclonal Antibody against Human PRUNE1, Gene description: prune exopolyphosphatase, Alternative Gene Names: DRES-17, H-PRUNE, HTCD37, PRUNE, Validated applications: ICC, IHC, WB, Uniprot ID: Q86TP1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name PRUNE1
Gene Description prune exopolyphosphatase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence LERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSAYFDSMKIPSGQPETADVSREQ
Immunogen LERSHSPPLKLTPASSTHPNLHAYLQGNTQVSRKKLLPLLQEALSAYFDSMKIPSGQPETADVSREQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DRES-17, H-PRUNE, HTCD37, PRUNE
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q86TP1
HTS Code 3002150000
Gene ID 58497
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-PRUNE1 Antibody 25ul

Anti-PRUNE1 Antibody 25ul