ABL1,ABL,c-ABL,JTK7
  • ABL1,ABL,c-ABL,JTK7

Anti-ABL1 Antibody 100ul

Ref: AN-HPA028409-100ul
Anti-ABL1

Información del producto

Polyclonal Antibody against Human ABL1, Gene description: ABL proto-oncogene 1, non-receptor tyrosine kinase, Alternative Gene Names: ABL, c-ABL, JTK7, p150, Validated applications: ICC, IHC, Uniprot ID: P00519, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ABL1
Gene Description ABL proto-oncogene 1, non-receptor tyrosine kinase
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence PTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLT
Immunogen PTPPKRSSSFREMDGQPERRGAGEEEGRDISNGALAFTPLDTADPAKSPKPSNGAGVPNGALRESGGSGFRSPHLWKKSSTLT
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ABL, c-ABL, JTK7, p150
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P00519
HTS Code 3002150000
Gene ID 25
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ABL1 Antibody 100ul

Anti-ABL1 Antibody 100ul