SPATA6,FLJ10007
  • SPATA6,FLJ10007

Anti-SPATA6 Antibody 100ul

Ref: AN-HPA028234-100ul
Anti-SPATA6

Información del producto

Polyclonal Antibody against Human SPATA6, Gene description: spermatogenesis associated 6, Alternative Gene Names: FLJ10007, SRF-1, SRF1, Validated applications: ICC, Uniprot ID: Q9NWH7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SPATA6
Gene Description spermatogenesis associated 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence FELIQLVPPVGETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRISGLRGNAPRLEFSTTSVITECLISSRKCHTQ
Immunogen FELIQLVPPVGETLSTYDENTRDFMFPGPNQMSGHHDSNRQVTMRRISGLRGNAPRLEFSTTSVITECLISSRKCHTQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10007, SRF-1, SRF1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NWH7
HTS Code 3002150000
Gene ID 54558
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SPATA6 Antibody 100ul

Anti-SPATA6 Antibody 100ul