CCDC18,NY-SAR-41
  • CCDC18,NY-SAR-41

Anti-CCDC18 Antibody 25ul

Ref: AN-HPA028035-25ul
Anti-CCDC18

Información del producto

Polyclonal Antibody against Human CCDC18, Gene description: coiled-coil domain containing 18, Alternative Gene Names: NY-SAR-41, Validated applications: ICC, IHC, Uniprot ID: Q5T9S5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name CCDC18
Gene Description coiled-coil domain containing 18
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence HQVESVKDQNQHTMNKQYEKERQRLVTGIEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKLESEMTKKCSQLLTLEKQLEEKI
Immunogen HQVESVKDQNQHTMNKQYEKERQRLVTGIEELRTKLIQIEAENSDLKVNMAHRTSQFQLIQEELLEKASNSSKLESEMTKKCSQLLTLEKQLEEKI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names NY-SAR-41
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5T9S5
HTS Code 3002150000
Gene ID 343099
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CCDC18 Antibody 25ul

Anti-CCDC18 Antibody 25ul