TPD52L1,D53,hD53
  • TPD52L1,D53,hD53

Anti-TPD52L1 Antibody 100ul

Ref: AN-HPA027916-100ul
Anti-TPD52L1

Información del producto

Polyclonal Antibody against Human TPD52L1, Gene description: tumor protein D52-like 1, Alternative Gene Names: D53, hD53, Validated applications: ICC, IHC, WB, Uniprot ID: Q16890, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TPD52L1
Gene Description tumor protein D52-like 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEI
Immunogen MEAQAQGLLETEPLQGTDEDAVASADFSSMLSEEEKEELKAELVQLEDEITTLRQVLSAKERHLVEI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names D53, hD53
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q16890
HTS Code 3002150000
Gene ID 7164
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TPD52L1 Antibody 100ul

Anti-TPD52L1 Antibody 100ul