TBC1D22B,C6orf197
  • TBC1D22B,C6orf197

Anti-TBC1D22B Antibody 25ul

Ref: AN-HPA027910-25ul
Anti-TBC1D22B

Información del producto

Polyclonal Antibody against Human TBC1D22B, Gene description: TBC1 domain family, member 22B, Alternative Gene Names: C6orf197, dJ744I24.2, FLJ20337, Validated applications: IHC, Uniprot ID: Q9NU19, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name TBC1D22B
Gene Description TBC1 domain family, member 22B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LATAAQVLENHSKLRVKPERSQSTTSDVPANYKVIKSSSDAQLSRNSSDTCLRNPLHKQQSLPLR
Immunogen LATAAQVLENHSKLRVKPERSQSTTSDVPANYKVIKSSSDAQLSRNSSDTCLRNPLHKQQSLPLR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C6orf197, dJ744I24.2, FLJ20337
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NU19
HTS Code 3002150000
Gene ID 55633
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TBC1D22B Antibody 25ul

Anti-TBC1D22B Antibody 25ul