TSSK1B,FKSG81
  • TSSK1B,FKSG81

Anti-TSSK1B Antibody 100ul

Ref: AN-HPA027827-100ul
Anti-TSSK1B

Información del producto

Polyclonal Antibody against Human TSSK1B, Gene description: testis-specific serine kinase 1B, Alternative Gene Names: FKSG81, SPOGA4, STK22D, TSSK1, Validated applications: IHC, WB, Uniprot ID: Q9BXA7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name TSSK1B
Gene Description testis-specific serine kinase 1B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence KSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPSTMETEEGPPQQPPETR
Immunogen KSATKLEPEGEAQPQAQPETKPEGTAMQMSRQSEILGFPSKPSTMETEEGPPQQPPETR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FKSG81, SPOGA4, STK22D, TSSK1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BXA7
HTS Code 3002150000
Gene ID 83942
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-TSSK1B Antibody 100ul

Anti-TSSK1B Antibody 100ul