RIMKLA,FAM80A
  • RIMKLA,FAM80A

Anti-RIMKLA Antibody 25ul

Ref: AN-HPA027826-25ul
Anti-RIMKLA

Información del producto

Polyclonal Antibody against Human RIMKLA, Gene description: ribosomal modification protein rimK-like family member A, Alternative Gene Names: FAM80A, MGC47816, NAAGS-II, RP11-157D18.1, Validated applications: IHC, Uniprot ID: Q8IXN7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RIMKLA
Gene Description ribosomal modification protein rimK-like family member A
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence DYTMSLLPNRQTGKMAVLPGLSSPREKNEPDGCASAQGVAESVYTINSGSTSSESEPELGEIRDSSASTMGAPPSMLPEPGYNINNRIASELK
Immunogen DYTMSLLPNRQTGKMAVLPGLSSPREKNEPDGCASAQGVAESVYTINSGSTSSESEPELGEIRDSSASTMGAPPSMLPEPGYNINNRIASELK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FAM80A, MGC47816, NAAGS-II, RP11-157D18.1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8IXN7
HTS Code 3002150000
Gene ID 284716
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RIMKLA Antibody 25ul

Anti-RIMKLA Antibody 25ul