GBP6,DKFZp686G0786
  • GBP6,DKFZp686G0786

Anti-GBP6 Antibody 25ul

Ref: AN-HPA027744-25ul
Anti-GBP6

Información del producto

Polyclonal Antibody against Human GBP6, Gene description: guanylate binding protein family, member 6, Alternative Gene Names: DKFZp686G0786, Validated applications: IHC, WB, Uniprot ID: Q6ZN66, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GBP6
Gene Description guanylate binding protein family, member 6
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence EREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGV
Immunogen EREHLLREQIMMLEHTQKVQNDWLHEGFKKKYEEMNAEISQFKRMIDTTKNDDTPWIARTLDNLADELTAILSAPAKLIGHGVKGV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZp686G0786
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q6ZN66
HTS Code 3002150000
Gene ID 163351
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GBP6 Antibody 25ul

Anti-GBP6 Antibody 25ul