DBNL,HIP-55,SH3P7
  • DBNL,HIP-55,SH3P7

Anti-DBNL Antibody 100ul

Ref: AN-HPA027735-100ul
Anti-DBNL

Información del producto

Polyclonal Antibody against Human DBNL, Gene description: drebrin-like, Alternative Gene Names: HIP-55, SH3P7, Validated applications: IHC, WB, Uniprot ID: Q9UJU6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name DBNL
Gene Description drebrin-like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence PPEQETFYEQPPLVQQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGH
Immunogen PPEQETFYEQPPLVQQQGAGSEHIDHHIQGQGLSGQGLCARALYDYQAADDTEISFDPENLITGIEVIDEGWWRGYGPDGH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names HIP-55, SH3P7
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9UJU6
HTS Code 3002150000
Gene ID 28988
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-DBNL Antibody 100ul

Anti-DBNL Antibody 100ul