ID2,bHLHb26,GIG8
  • ID2,bHLHb26,GIG8

Anti-ID2 Antibody 25ul

Ref: AN-HPA027612-25ul
Anti-ID2

Información del producto

Polyclonal Antibody against Human ID2, Gene description: inhibitor of DNA binding 2, dominant negative helix-loop-helix protein, Alternative Gene Names: bHLHb26, GIG8, Validated applications: ICC, Uniprot ID: Q02363, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name ID2
Gene Description inhibitor of DNA binding 2, dominant negative helix-loop-helix protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence MEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Immunogen MEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEFPSELMSNDSKALCG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bHLHb26, GIG8
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q02363
HTS Code 3002150000
Gene ID 3398
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ID2 Antibody 25ul

Anti-ID2 Antibody 25ul