VPS45,h-vps45,H1
  • VPS45,h-vps45,H1

Anti-VPS45 Antibody 100ul

Ref: AN-HPA027441-100ul
Anti-VPS45

Información del producto

Polyclonal Antibody against Human VPS45, Gene description: vacuolar protein sorting 45 homolog (S. cerevisiae), Alternative Gene Names: h-vps45, H1, VPS45A, VPS45B, Validated applications: IHC, WB, Uniprot ID: Q9NRW7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name VPS45
Gene Description vacuolar protein sorting 45 homolog (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence LLNQWTYQAMVHELLGINNNRIDLSRVPGISKDLREVVLSAENDEFYANNMYLNFAEIGSNIKNLMEDFQKKKPKEQQKLESIADMKAFVENYPQFK
Immunogen LLNQWTYQAMVHELLGINNNRIDLSRVPGISKDLREVVLSAENDEFYANNMYLNFAEIGSNIKNLMEDFQKKKPKEQQKLESIADMKAFVENYPQFK
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names h-vps45, H1, VPS45A, VPS45B
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9NRW7
HTS Code 3002150000
Gene ID 11311
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-VPS45 Antibody 100ul

Anti-VPS45 Antibody 100ul