USH1C,AIE-75,DFNB18
  • USH1C,AIE-75,DFNB18

Anti-USH1C Antibody 25ul

Ref: AN-HPA027398-25ul
Anti-USH1C

Información del producto

Polyclonal Antibody against Human USH1C, Gene description: Usher syndrome 1C (autosomal recessive, severe), Alternative Gene Names: AIE-75, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-73, PDZ73, PDZD7C, Validated applications: ICC, IHC, WB, Uniprot ID: Q9Y6N9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name USH1C
Gene Description Usher syndrome 1C (autosomal recessive, severe)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse
Applications WB, IHC, ICC
Sequence IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRKYEEGFDPYSM
Immunogen IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRKYEEGFDPYSM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names AIE-75, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-73, PDZ73, PDZD7C
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y6N9
HTS Code 3002150000
Gene ID 10083
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-USH1C Antibody 25ul

Anti-USH1C Antibody 25ul