VPS13D,FLJ10619
  • VPS13D,FLJ10619

Anti-VPS13D Antibody 25ul

Ref: AN-HPA027332-25ul
Anti-VPS13D

Información del producto

Polyclonal Antibody against Human VPS13D, Gene description: vacuolar protein sorting 13 homolog D (S. cerevisiae), Alternative Gene Names: FLJ10619, KIAA0453, Validated applications: ICC, Uniprot ID: Q5THJ4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name VPS13D
Gene Description vacuolar protein sorting 13 homolog D (S. cerevisiae)
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence WSGGFEVNKNNSFHINMRDTLGKCFFLRVEITLRGATYRISFSDTDQLPPPFRIDNFSKVPVVFTQHGVAEPRLRTEVKPM
Immunogen WSGGFEVNKNNSFHINMRDTLGKCFFLRVEITLRGATYRISFSDTDQLPPPFRIDNFSKVPVVFTQHGVAEPRLRTEVKPM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ10619, KIAA0453
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q5THJ4
HTS Code 3002150000
Gene ID 55187
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-VPS13D Antibody 25ul

Anti-VPS13D Antibody 25ul