S100PBP,FLJ12903
  • S100PBP,FLJ12903

Anti-S100PBP Antibody 25ul

Ref: AN-HPA027328-25ul
Anti-S100PBP

Información del producto

Polyclonal Antibody against Human S100PBP, Gene description: S100P binding protein, Alternative Gene Names: FLJ12903, S100PBPR, Validated applications: ICC, IHC, WB, Uniprot ID: Q96BU1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name S100PBP
Gene Description S100P binding protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence PDLFKLPQLSTSSGHGPAHTKPLNRRSVLEKNLIKVTVAPFNPTVCDALLDKDETDSSKDTEKLSSLGEEMREDGLSPNESKLCTESEGISPNNS
Immunogen PDLFKLPQLSTSSGHGPAHTKPLNRRSVLEKNLIKVTVAPFNPTVCDALLDKDETDSSKDTEKLSSLGEEMREDGLSPNESKLCTESEGISPNNS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ12903, S100PBPR
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96BU1
HTS Code 3002150000
Gene ID 64766
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-S100PBP Antibody 25ul

Anti-S100PBP Antibody 25ul