WDR77,MEP50
  • WDR77,MEP50

Anti-WDR77 Antibody 25ul

Ref: AN-HPA027271-25ul
Anti-WDR77

Información del producto

Polyclonal Antibody against Human WDR77, Gene description: WD repeat domain 77, Alternative Gene Names: MEP50, Validated applications: ICC, IHC, WB, Uniprot ID: Q9BQA1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name WDR77
Gene Description WD repeat domain 77
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence SEDCSIAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE
Immunogen SEDCSIAVLDSSLSELFRSQAHRDFVRDATWSPLNHSLLTTVGWDHQVVHHVVPTEPLPAPGPASVTE
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MEP50
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9BQA1
HTS Code 3002150000
Gene ID 79084
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-WDR77 Antibody 25ul

Anti-WDR77 Antibody 25ul