SIGLEC10,MGC126774
  • SIGLEC10,MGC126774

Anti-SIGLEC10 Antibody 100ul

Ref: AN-HPA027093-100ul
Anti-SIGLEC10

Información del producto

Polyclonal Antibody against Human SIGLEC10, Gene description: sialic acid binding Ig-like lectin 10, Alternative Gene Names: MGC126774, PRO940, SIGLEC-10, SLG2, Validated applications: IHC, WB, Uniprot ID: Q96LC7, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name SIGLEC10
Gene Description sialic acid binding Ig-like lectin 10
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence DGRFWIRVQESVMVPEGLCISVPCSFSYPRQDWTGSTPAYGYWFKAVTETTKGAPVATNHQSREVEMSTRGRFQLTGDPAKGNCSLVIRDAQMQDESQY
Immunogen DGRFWIRVQESVMVPEGLCISVPCSFSYPRQDWTGSTPAYGYWFKAVTETTKGAPVATNHQSREVEMSTRGRFQLTGDPAKGNCSLVIRDAQMQDESQY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MGC126774, PRO940, SIGLEC-10, SLG2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96LC7
HTS Code 3002150000
Gene ID 89790
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-SIGLEC10 Antibody 100ul

Anti-SIGLEC10 Antibody 100ul