GPR182,ADMR,AM-R
  • GPR182,ADMR,AM-R

Anti-GPR182 Antibody 25ul

Ref: AN-HPA027037-25ul
Anti-GPR182

Información del producto

Polyclonal Antibody against Human GPR182, Gene description: G protein-coupled receptor 182, Alternative Gene Names: ADMR, AM-R, G10D, hrhAMR, Validated applications: IHC, Uniprot ID: O15218, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name GPR182
Gene Description G protein-coupled receptor 182
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence LSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
Immunogen LSPHFRGRLLNAVVHYLPKDQTKAGTCASSSSCSTQHSIIITKGDSQPAAAAPHPEPSLSFQAHHLLPNTSPISPTQPLTPS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names ADMR, AM-R, G10D, hrhAMR
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID O15218
HTS Code 3002150000
Gene ID 11318
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-GPR182 Antibody 25ul

Anti-GPR182 Antibody 25ul