C4orf3
  • C4orf3

Anti-C4orf3 Antibody 100ul

Ref: AN-HPA026907-100ul
Anti-C4orf3

Información del producto

Polyclonal Antibody against Human C4orf3, Gene description: chromosome 4 open reading frame 3, Validated applications: IHC, Uniprot ID: Q8WVX3, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C4orf3
Gene Description chromosome 4 open reading frame 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKH
Immunogen MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKH
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WVX3
HTS Code 3002150000
Gene ID 401152
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C4orf3 Antibody 100ul

Anti-C4orf3 Antibody 100ul