C12orf49,FLJ21415
  • C12orf49,FLJ21415

Anti-C12orf49 Antibody 100ul

Ref: AN-HPA026905-100ul
Anti-C12orf49

Información del producto

Polyclonal Antibody against Human C12orf49, Gene description: chromosome 12 open reading frame 49, Alternative Gene Names: FLJ21415, Validated applications: IHC, WB, Uniprot ID: Q9H741, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C12orf49
Gene Description chromosome 12 open reading frame 49
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC
Sequence NLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSS
Immunogen NLLQVHDHNQPIPWKVQFNLGNSSRPSNQCRNSIQGKHLITDELGYVCERKDLLVNGCCNVNVPSTKQYCCDGCWPNGCCSAYEYCVSCCLQPNKQLLLERFLNRAAVAFQNLFMAVEDHFELCLAKCRTSS
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ21415
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H741
HTS Code 3002150000
Gene ID 79794
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C12orf49 Antibody 100ul

Anti-C12orf49 Antibody 100ul