WRAP73,WDR8
  • WRAP73,WDR8

Anti-WRAP73 Antibody 100ul

Ref: AN-HPA026893-100ul
Anti-WRAP73

Información del producto

Polyclonal Antibody against Human WRAP73, Gene description: WD repeat containing, antisense to TP73, Alternative Gene Names: WDR8, Validated applications: ICC, IHC, Uniprot ID: Q9P2S5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name WRAP73
Gene Description WD repeat containing, antisense to TP73
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence SVPVSLQTLKPVTDRANPKIGIGMLAFSPDSYFLATRNDNIPNAVWVWDIQKLRLFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGEGDFAVLSLCWHLSGDSM
Immunogen SVPVSLQTLKPVTDRANPKIGIGMLAFSPDSYFLATRNDNIPNAVWVWDIQKLRLFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGEGDFAVLSLCWHLSGDSM
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names WDR8
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9P2S5
HTS Code 3002150000
Gene ID 49856
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-WRAP73 Antibody 100ul

Anti-WRAP73 Antibody 100ul