CCDC126,FLJ23031
  • CCDC126,FLJ23031

Anti-CCDC126 Antibody 100ul

Ref: AN-HPA026883-100ul
Anti-CCDC126

Información del producto

Polyclonal Antibody against Human CCDC126, Gene description: coiled-coil domain containing 126, Alternative Gene Names: FLJ23031, Validated applications: ICC, IHC, Uniprot ID: Q96EE4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name CCDC126
Gene Description coiled-coil domain containing 126
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, ICC
Sequence VKLREQILDLSKRYVKALAEENKNTVDVENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSAANTTNGTSGNLVPVTTNKRTNVSGSI
Immunogen VKLREQILDLSKRYVKALAEENKNTVDVENGASMAGYADLKRTIAVLLDDILQRLVKLENKVDYIVVNGSAANTTNGTSGNLVPVTTNKRTNVSGSI
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ23031
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96EE4
HTS Code 3002150000
Gene ID 90693
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-CCDC126 Antibody 100ul

Anti-CCDC126 Antibody 100ul