FCER1G
  • FCER1G

Anti-FCER1G Antibody 100ul

Ref: AN-HPA026872-100ul
Anti-FCER1G

Información del producto

Polyclonal Antibody against Human FCER1G, Gene description: Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide, Validated applications: IHC, Uniprot ID: P30273, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name FCER1G
Gene Description Fc fragment of IgE, high affinity I, receptor for
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Immunogen KIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID P30273
HTS Code 3002150000
Gene ID 2207
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-FCER1G Antibody 100ul

Anti-FCER1G Antibody 100ul