STAB2,DKFZP434E0321
  • STAB2,DKFZP434E0321

Anti-STAB2 Antibody 25ul

Ref: AN-HPA026871-25ul
Anti-STAB2

Información del producto

Polyclonal Antibody against Human STAB2, Gene description: stabilin 2, Alternative Gene Names: DKFZP434E0321, FEEL-2, FELL, HARE, STAB-2, Validated applications: ICC, IHC, Uniprot ID: Q8WWQ8, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name STAB2
Gene Description stabilin 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC
Sequence VVLEEKLLKNDLHNGMHRETMLGFSYFLSFFLHNDQLYVNEAPINYTNVATDKGVIHGLGKVLEIQKNRCDNNDTTIIRGRCRTCSSELTCPFGTKSLGNEKRRCIYTSYFMGRRTLFIGCQPKCVRTVITR
Immunogen VVLEEKLLKNDLHNGMHRETMLGFSYFLSFFLHNDQLYVNEAPINYTNVATDKGVIHGLGKVLEIQKNRCDNNDTTIIRGRCRTCSSELTCPFGTKSLGNEKRRCIYTSYFMGRRTLFIGCQPKCVRTVITR
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names DKFZP434E0321, FEEL-2, FELL, HARE, STAB-2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8WWQ8
HTS Code 3002150000
Gene ID 55576
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-STAB2 Antibody 25ul

Anti-STAB2 Antibody 25ul