BNIP2,BNIP-2,Nip2
  • BNIP2,BNIP-2,Nip2

Anti-BNIP2 Antibody 100ul

Ref: AN-HPA026843-100ul
Anti-BNIP2

Información del producto

Polyclonal Antibody against Human BNIP2, Gene description: BCL2/adenovirus E1B 19kDa interacting protein 2, Alternative Gene Names: BNIP-2, Nip2, Validated applications: IHC, WB, Uniprot ID: Q12982, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name BNIP2
Gene Description BCL2/adenovirus E1B 19kDa interacting protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Rat
Applications WB, IHC
Sequence VELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRV
Immunogen VELKEEWQDEDFPIPLPEDDSIEADILAITGPEDQPGSLEVNGNKVRKKLMAPDISLTLDPSDGSVLSDDLDESGEIDLDGLDTPSENSNEFEWEDDLPKPKTTEVIRKGSITEYTAAEEKEDGRRWRMFRIGEQDHRV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BNIP-2, Nip2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q12982
HTS Code 3002150000
Gene ID 663
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-BNIP2 Antibody 100ul

Anti-BNIP2 Antibody 100ul