RNF2,BAP-1,BAP1
  • RNF2,BAP-1,BAP1

Anti-RNF2 Antibody 25ul

Ref: AN-HPA026803-25ul
Anti-RNF2

Información del producto

Polyclonal Antibody against Human RNF2, Gene description: ring finger protein 2, Alternative Gene Names: BAP-1, BAP1, DING, HIPI3, RING1B, RING2, Validated applications: ICC, IHC, WB, Uniprot ID: Q99496, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name RNF2
Gene Description ring finger protein 2
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC, IHC, WB
Sequence ALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELV
Immunogen ALISKIYPSRDEYEAHQERVLARINKHNNQQALSHSIEEGLKIQAMNRLQRGKKQQIENGSGAEDNGDSSHCSNASTHSNQEAGPSNKRTKTSDDSGLELDNNNAAMAIDPVMDGASEIELV
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names BAP-1, BAP1, DING, HIPI3, RING1B, RING2
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q99496
HTS Code 3002150000
Gene ID 6045
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RNF2 Antibody 25ul

Anti-RNF2 Antibody 25ul