ZNF804B,FLJ32110
  • ZNF804B,FLJ32110

Anti-ZNF804B Antibody 100ul

Ref: AN-HPA026702-100ul
Anti-ZNF804B

Información del producto

Polyclonal Antibody against Human ZNF804B, Gene description: zinc finger protein 804B, Alternative Gene Names: FLJ32110, Validated applications: IHC, Uniprot ID: A4D1E1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name ZNF804B
Gene Description zinc finger protein 804B
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC
Sequence KEVNISPSHLESVLHNTISINSKILQDKHDSIDETLEDSIGIHASFSKSNIHLSDVDFTPTSREKETRNTLKNTLENCVNHPCQANASFSPPNIYNHSDARISECLDEFSSLEP
Immunogen KEVNISPSHLESVLHNTISINSKILQDKHDSIDETLEDSIGIHASFSKSNIHLSDVDFTPTSREKETRNTLKNTLENCVNHPCQANASFSPPNIYNHSDARISECLDEFSSLEP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names FLJ32110
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID A4D1E1
HTS Code 3002150000
Gene ID 219578
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-ZNF804B Antibody 100ul

Anti-ZNF804B Antibody 100ul