VPS50,CCDC132
  • VPS50,CCDC132

Anti-VPS50 Antibody 100ul

Ref: AN-HPA026679-100ul
Anti-VPS50

Información del producto

Polyclonal Antibody against Human VPS50, Gene description: VPS50 EARP/GARPII complex subunit, Alternative Gene Names: CCDC132, DKFZp313I2429, FLJ20097, KIAA1861, VPS54L, Validated applications: IHC, WB, Uniprot ID: Q96JG6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name VPS50
Gene Description VPS50 EARP/GARPII complex subunit
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence QSRSPSVSPSKQPVSTSSKTVTLFEQYCSGGNPFEIQANHKDEETEDVLASNGYESDEQEKSAYQEYDSDSDVPEELKRDYVDEQTGDGPVKSVSRETLKSRKKSDYSLNKVNAP
Immunogen QSRSPSVSPSKQPVSTSSKTVTLFEQYCSGGNPFEIQANHKDEETEDVLASNGYESDEQEKSAYQEYDSDSDVPEELKRDYVDEQTGDGPVKSVSRETLKSRKKSDYSLNKVNAP
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CCDC132, DKFZp313I2429, FLJ20097, KIAA1861, VPS54L
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96JG6
HTS Code 3002150000
Gene ID 55610
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-VPS50 Antibody 100ul

Anti-VPS50 Antibody 100ul