RUBCNL,C13orf18
  • RUBCNL,C13orf18

Anti-RUBCNL Antibody 100ul

Ref: AN-HPA026614-100ul
Anti-RUBCNL

Información del producto

Polyclonal Antibody against Human RUBCNL, Gene description: RUN and cysteine rich domain containing beclin 1 interacting protein like, Alternative Gene Names: C13orf18, FLJ21562, KIAA0226L, Validated applications: ICC, IHC, WB, Uniprot ID: Q9H714, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RUBCNL
Gene Description RUN and cysteine rich domain containing beclin 1 interacting protein like
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence AVQVSRRTISSNSFSPEVFVLPVDVEKENAHFYVADMIISAMEKMKCNILSQQQTESWSKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVSPVTETRTYHDVKEICKCDVDEFVILELGDF
Immunogen AVQVSRRTISSNSFSPEVFVLPVDVEKENAHFYVADMIISAMEKMKCNILSQQQTESWSKEVSGLLGSDQPDSEMTFDTNIKQESGSSTSSYSGYEGCAVLQVSPVTETRTYHDVKEICKCDVDEFVILELGDF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names C13orf18, FLJ21562, KIAA0226L
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9H714
HTS Code 3002150000
Gene ID 80183
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RUBCNL Antibody 100ul

Anti-RUBCNL Antibody 100ul