RMDN1,CGI-90,FAM82B
  • RMDN1,CGI-90,FAM82B

Anti-RMDN1 Antibody 100ul

Ref: AN-HPA026495-100ul
Anti-RMDN1

Información del producto

Polyclonal Antibody against Human RMDN1, Gene description: regulator of microtubule dynamics 1, Alternative Gene Names: CGI-90, FAM82B, FLJ20665, RMD1, Validated applications: ICC, IHC, WB, Uniprot ID: Q96DB5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name RMDN1
Gene Description regulator of microtubule dynamics 1
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications WB, IHC, ICC
Sequence RLARASRDVAQLSRTSEEEKKLLVYEALEYAKRALEKNESSFASHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIELNPKDATSIHL
Immunogen RLARASRDVAQLSRTSEEEKKLLVYEALEYAKRALEKNESSFASHKWYAICLSDVGDYEGIKAKIANAYIIKEHFEKAIELNPKDATSIHL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names CGI-90, FAM82B, FLJ20665, RMD1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q96DB5
HTS Code 3002150000
Gene ID 51115
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-RMDN1 Antibody 100ul

Anti-RMDN1 Antibody 100ul