C1QBP,gC1Q-R,gC1qR
  • C1QBP,gC1Q-R,gC1qR

Anti-C1QBP Antibody 100ul

Ref: AN-HPA026483-100ul
Anti-C1QBP

Información del producto

Polyclonal Antibody against Human C1QBP, Gene description: complement component 1, q subcomponent binding protein, Alternative Gene Names: gC1Q-R, gC1qR, HABP1, p32, SF2p32, Validated applications: ICC, IHC, WB, Uniprot ID: Q07021, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name C1QBP
Gene Description complement component 1, q subcomponent binding protein
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications WB, IHC, ICC
Sequence GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY
Immunogen GGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHY
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names gC1Q-R, gC1qR, HABP1, p32, SF2p32
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q07021
HTS Code 3002150000
Gene ID 708
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-C1QBP Antibody 100ul

Anti-C1QBP Antibody 100ul