STK35,bA550O8.2
  • STK35,bA550O8.2

Anti-STK35 Antibody 100ul

Ref: AN-HPA026452-100ul
Anti-STK35

Información del producto

Polyclonal Antibody against Human STK35, Gene description: serine/threonine kinase 35, Alternative Gene Names: bA550O8.2, CLIK1, Validated applications: ICC, Uniprot ID: Q8TDR2, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name STK35
Gene Description serine/threonine kinase 35
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications ICC
Sequence TSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVETSLKGERILGYAEEPCYLWF
Immunogen TSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVETSLKGERILGYAEEPCYLWF
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names bA550O8.2, CLIK1
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q8TDR2
HTS Code 3002150000
Gene ID 140901
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-STK35 Antibody 100ul

Anti-STK35 Antibody 100ul