AKT3,PKBG,PRKBG
  • AKT3,PKBG,PRKBG

Anti-AKT3 Antibody 100ul

Ref: AN-HPA026441-100ul
Anti-AKT3

Información del producto

Polyclonal Antibody against Human AKT3, Gene description: v-akt murine thymoma viral oncogene homolog 3, Alternative Gene Names: PKBG, PRKBG, RAC-gamma, Validated applications: IHC, WB, Uniprot ID: Q9Y243, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 100ul
Gene Name AKT3
Gene Description v-akt murine thymoma viral oncogene homolog 3
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human
Applications IHC, WB
Sequence EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL
Immunogen EEREEWTEAIQAVADRLQRQEEERMNCSPTSQIDNIGEEEMDASTTHHKRKTMNDFDYLKLL
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names PKBG, PRKBG, RAC-gamma
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y243
HTS Code 3002150000
Gene ID 10000
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-AKT3 Antibody 100ul

Anti-AKT3 Antibody 100ul