STK24,MST-3,MST3
  • STK24,MST-3,MST3

Anti-STK24 Antibody 25ul

Ref: AN-HPA026435-25ul
Anti-STK24

Información del producto

Polyclonal Antibody against Human STK24, Gene description: serine/threonine kinase 24, Alternative Gene Names: MST-3, MST3, MST3B, STE20, STK3, Validated applications: IHC, WB, Uniprot ID: Q9Y6E0, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

See DataSheet here

" target="_blank">See DataSheet here

https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf target=_blank">Click here for MSDS in PDF

Click here for image

Información adicional
Size 25ul
Gene Name STK24
Gene Description serine/threonine kinase 24
Storage Conditions Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Shipping Conditions Normally shipped at ambient temperature
Species Reactivity Cross Human, Mouse, Rat
Applications IHC, WB
Sequence QCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGG
Immunogen QCLSTIISPLFAELKEKSQACGGNLGSIEELRGAIYLAEEACPGISDTMVAQLVQRLQRYSLSGG
Storage Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Product Group Polyclonal Antibodies
Alternative Names MST-3, MST3, MST3B, STE20, STK3
Category Polyclonal
Isoelectric Point IgG
Host RABBIT
UniProt ID Q9Y6E0
HTS Code 3002150000
Gene ID 8428
Buffer Formulation 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Purification Affinity purified using the PrEST antigen as affinity ligand
Iso type IgG
Conjugation Unconjugated

Enviar uma mensagem


Anti-STK24 Antibody 25ul

Anti-STK24 Antibody 25ul